PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.1612s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 231aa    MW: 25559.8 Da    PI: 10.4644
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.1612s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.43.2e-331468155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprlrWtpeLH++Fv+av++LGG+ekAtPk++++lm++kgLtl+h+kSHLQkYR+
  Kalax.1612s0003.1.p 14 KPRLRWTPELHSCFVDAVAKLGGPEKATPKAVMRLMGLKGLTLYHLKSHLQKYRI 68
                         79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.4271171IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-311269IPR009057Homeodomain-like
SuperFamilySSF466893.94E-161371IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-231469IPR006447Myb domain, plants
PfamPF002491.4E-91667IPR001005SANT/Myb domain
PfamPF143792.1E-16115154IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MERGYVGGKA AEPKPRLRWT PELHSCFVDA VAKLGGPEKA TPKAVMRLMG LKGLTLYHLK  60
SHLQKYRIGQ QARKSSSEQS KDSSGDSRKM QASGATATSS GACSGQGDAA LIYAARSQTQ  120
AQNRLHDQLQ VQRRLQMRIE AQGKYLQSVL EKARTNLTLR TGSSPAASSD QARAQQLTGF  180
NLALEDDVNG VQKDTEANFR SKDFFQSFLQ NQRREMQEDE KPDVKQLRLF *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002264257.25e-64PREDICTED: myb family transcription factor APL
SwissprotQ9SAK51e-48APL_ARATH; Myb family transcription factor APL
TrEMBLD7U3R95e-64D7U3R9_VITVI; Putative uncharacterized protein
STRINGVIT_02s0033g00300.t011e-63(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.19e-48G2-like family protein